PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.D00842.1.p
Common NameLOC105959785, MIMGU_mgv1a004351mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 532aa    MW: 58496 Da    PI: 7.4692
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.D00842.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.61.3e-33203261260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers+ d+ ++ei+Y+g+Hnh+k
  Migut.D00842.1.p 203 EDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSNLDGAITEIVYKGSHNHPK 261
                       7********************************************************85 PP

2WRKY106.21.7e-33382439259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dgy+WrKYGqK+vkg+++prsYY+Cts++Cpv+k+ver+a+dp++v++tYeg+Hnh+
  Migut.D00842.1.p 382 VDGYKWRKYGQKVVKGNPNPRSYYKCTSPSCPVRKHVERAAHDPRAVITTYEGKHNHD 439
                       5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-29198262IPR003657WRKY domain
SuperFamilySSF1182902.88E-26200262IPR003657WRKY domain
SMARTSM007742.5E-37202261IPR003657WRKY domain
PfamPF031069.7E-26203260IPR003657WRKY domain
PROSITE profilePS5081125.913203262IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-36366441IPR003657WRKY domain
SuperFamilySSF1182901.23E-28373441IPR003657WRKY domain
PROSITE profilePS5081137.172376441IPR003657WRKY domain
SMARTSM007747.4E-38381440IPR003657WRKY domain
PfamPF031061.3E-25383439IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MSSTSFTSLL ASDHHLSAAA TTTTTSAAAA VSRGLGDRIA ERTGSGIPKF KSLPPPSLSR  60
PPPSAVSPSS WFAIPPGLSP AELLDSPILL SSSNILPSPT TGSFPVHNSF NWNSKSQQQT  120
DNFKYEEHNN SFSDFSFQTQ TNPISSHDNM GNQKWGNYNE STKLESAVDS KPESNSVPSF  180
STGIASIQTN DDKNNVISNR KSEDGYNWRK YGQKQVKGSE NPRSYYKCTY PNCPTKKKVE  240
RSNLDGAITE IVYKGSHNHP KPQSTRKSSS STSANQSYNN NNNNNSHFIN EIIQEHSYGS  300
NSMGKIDSLE NSNSISVDDD DLEQSSAKKS GHGEIEIDDE EPLQKRWKGE IETEGVVSAV  360
GNRAIREPRV VVQTTSDIDI LVDGYKWRKY GQKVVKGNPN PRSYYKCTSP SCPVRKHVER  420
AAHDPRAVIT TYEGKHNHDV PIARGSGTHR PIPNNIIPNN NNNNNSNYSM LMSNLRPSQL  480
VPYSLEMLQS ANGSIGYNNS DFGNSTVSEN GTYARAKDEP RDDLYLDSLL Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A8e-37181441277Probable WRKY transcription factor 4
1wj2_A8e-37181441277Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839429.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-102WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A022S2910.0A0A022S291_ERYGU; Uncharacterized protein
STRINGVIT_06s0004g07500.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-100WRKY DNA-binding protein 33